Protein Info for PP_3944 in Pseudomonas putida KT2440

Annotation: 6-hydroxynicotinate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01494: FAD_binding_3" amino acids 6 to 347 (342 residues), 96.9 bits, see alignment E=4.6e-31 PF13450: NAD_binding_8" amino acids 9 to 37 (29 residues), 31.1 bits, see alignment (E = 7e-11)

Best Hits

Swiss-Prot: 100% identical to 6HN3M_PSEPK: 6-hydroxynicotinate 3-monooxygenase (nicC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K14974, 6-hydroxynicotinate 3-monooxygenase [EC: 1.14.13.114] (inferred from 100% identity to ppu:PP_3944)

MetaCyc: 100% identical to 6-hydroxynicotinate 3-monooxygenase (Pseudomonas putida KT2440)
RXN-7573 [EC: 1.14.13.114]

Predicted SEED Role

"Salicylate hydroxylase (EC 1.14.13.1)" in subsystem Salicylate and gentisate catabolism or Salicylate ester degradation (EC 1.14.13.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.1

Use Curated BLAST to search for 1.14.13.1 or 1.14.13.114

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FY2 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PP_3944 6-hydroxynicotinate 3-monooxygenase (Pseudomonas putida KT2440)
MRGRQKIAIVGAGLGGAAAATLLQQAGFDVEVFEQAPAFTRLGAGIHIGPNVMKIFRRMG
LEQKLELMGSHPDFWFSRDGNTGDYLSRIPLGEFARREYGAAYITIHRGDLHALQIEAIQ
PGTVHFGKRLEKIVDEGDQVRLDFADGTHTVADIVIGADGIHSKIREELLGAEAPIYSGW
VAHRALIRGVNLAQHADVFEPCVKWWSEDRHMMVYYTTGKRDEYYFVTGVPHEAWDFQGA
FVDSSQEEMRAAFEGYHPTVQKLIDATESITKWPLRNRNPLPLWSRGRLVLLGDACHPMK
PHMAQGACMAIEDAAMLTRCLQETGLSDHRTAFALYEANRKERASQVQSVSNANTWLYSQ
EDPAWVYGYDLYGQQLESGEAA