Protein Info for PP_3932 in Pseudomonas putida KT2440

Annotation: Diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 66 to 105 (40 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 195 to 222 (28 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 298 to 466 (169 residues), 157.2 bits, see alignment E=1.6e-50 PF00990: GGDEF" amino acids 302 to 463 (162 residues), 146 bits, see alignment E=4.4e-47

Best Hits

KEGG orthology group: None (inferred from 98% identity to ppf:Pput_1902)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FZ4 at UniProt or InterPro

Protein Sequence (474 amino acids)

>PP_3932 Diguanylate cyclase (Pseudomonas putida KT2440)
MPVEFMVFPAQSRVLPYVVVVGVTFALTLGGILARPIESLSLFWPVNAVLAGVLLRYPRQ
ATFTGFSLVWLAMVGADLLCGSAWVPALWLNLCNLGVVVTLWQLLSRLPRMHRRMRSPHG
VLSVFAACAAAAMVAASMAAVMAAPWFEQSLRATWLAWFSEQFSTGVLVLPVLLTAPSVR
ALVRGGAQPIRLAPLLVLLASLAFSIAFGGPGAIAFPIAALLWCAWTYSPFLVSLLTLTA
GSTLIVAVAQNLMHFSVPQSEPGVTTLMSARLGIAMLVLGPLVVACVSQANRSLMARLAH
QATVDHLTGVLTRSAFTRRANALLESRQQHAQALPLTLMMLDIDHFKSINDAHGHAVGDQ
VLRQFASTLQDQLHNDELIARLGGEEFVVILPGLAPERANFTAERLRRAIQDLHVTQADQ
RLQITVSIGVAGCDADMPAPSLDELLASADQALYRAKARGRNRVEQAEAQRLVI