Protein Info for PP_3926 in Pseudomonas putida KT2440

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 12 to 205 (194 residues), 174.4 bits, see alignment E=3.1e-55 PF08659: KR" amino acids 15 to 125 (111 residues), 32.1 bits, see alignment E=1.7e-11 PF13561: adh_short_C2" amino acids 18 to 253 (236 residues), 223.1 bits, see alignment E=5.9e-70

Best Hits

Swiss-Prot: 38% identical to DHRS4_RABIT: Dehydrogenase/reductase SDR family member 4 (Fragment) (DHRS4) from Oryctolagus cuniculus

KEGG orthology group: None (inferred from 99% identity to ppg:PputGB1_3560)

MetaCyc: 37% identical to S-1-(4-hydroxyphenyl)-ethanol dehydrogenase (Aromatoleum aromaticum EbN1)
1.1.1.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G00 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PP_3926 short-chain dehydrogenase (Pseudomonas putida KT2440)
MSKTHLFDLDGKIAFVSGASRGIGEAIAHLLAQQGAHVIVSSRKLDGCQQVADAIIAAGG
KATAVACHIGELEQIQQVFAGIREQFGRLDVLVNNAATNPQFCNVLDTDPGAFQKTVDVN
IRGYFFMSVEAGKLMRENGGGSIINVASINGVSPGLFQGIYSVTKAAVINMTKVFAKECA
PFGIRCNALLPGLTDTKFASALVKNEAILNAALQQIPLKRVADPKEMAGAVLYLASDASS
YTTGTTLNVDGGFLS