Protein Info for PP_3881 in Pseudomonas putida KT2440

Annotation: putative Phage terminase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 PF03354: TerL_ATPase" amino acids 88 to 262 (175 residues), 96.2 bits, see alignment E=2e-31 PF20441: TerL_nuclease" amino acids 271 to 502 (232 residues), 85.1 bits, see alignment E=4.9e-28 amino acids 532 to 581 (50 residues), 28.8 bits, see alignment 7.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3881)

Predicted SEED Role

"Phage terminase, large subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G45 at UniProt or InterPro

Protein Sequence (602 amino acids)

>PP_3881 putative Phage terminase, large subunit (Pseudomonas putida KT2440)
MSQKKTSSRSSSVDDPATQYAKEVHSGERVAGPDIRNACARHLRDLEEGPKRGLTWDLDA
ANKAIRFYRTVLKLNGGEFEGLPFELLPWQKFIVGSIFGWKSSDGYRRFRVVYVESGKGS
GKSPLAAGVGLTGLIADNEARAEIYAAATKKDQAMILFRDAVAMVQQSPELTKRLVCSGT
GQNIWNLAYLKSGSFFRPISSDDGQSGPRPHMALIDEVHEHKTNMVVEMMRAGTKSRKQA
LIFMITNSGSNKRGPCWEYHEYGSRVASGALTDDGFFAYICSLDEGDDPIQDESCWFKSN
PSLQDADLPGMKYLREQVTEARGMPSKEAMVRRLNFCEWTGAESPWISWDVWSQAEERVP
MSLLRNRPSVGGLDLSSTTDLTSFVLLFYPTYEDPHWRLLPYFWIPDHELDKREARDKVP
YAAWIKSRDLETTPGRAISKLHVLRRLQTICDFFQVDKIAFDRWRIEDMRQLMSEYDITL
PELVEFGQGFKDMGPAVDEFERRLLGMIEQQPEEEGGAAEFFDDALPAEAVESLRHDGNP
VMTWCAGNAVIVSDPANNRKADKAKATGRIDGIIAAIMATGISGAVSSGSSGSSIYDEGV
GV