Protein Info for PP_3878 in Pseudomonas putida KT2440

Annotation: putative Phage minor capsid protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 168 to 169 (2 residues), see Phobius details amino acids 175 to 183 (9 residues), see Phobius details PF01343: Peptidase_S49" amino acids 148 to 295 (148 residues), 105.4 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3878)

Predicted SEED Role

"phage minor capsid protein C, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G48 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PP_3878 putative Phage minor capsid protein C (Pseudomonas putida KT2440)
MKRHLRAASLLFNQPLLTTPDMLDLAVRWANQTMSLNIVNLNMGGAAANPSMFYDDEDYQ
AEQDRREEQRRAAIAQTGVEVIPVHGVLVSRGSHLNACETMTSYEGLRAALNKAITDPMV
EHIVLDIDSPGGSAVGAFELAADIRAATKIKPITGLVNFMAYSGGYLIASACTEVVVSLT
SGVGSIGVVASHMDRSKMIEGMGVKVTTVFAGAHKNDLSPNEPITEQSLQVLNEVVQESY
QLFTTHVAEYRGRDVADIIATEAACYRGSSAIAIGLADRLESPQLAVDNLSRAVALSRAQ
RQGPQTQQRISVRASAFAIQSQL