Protein Info for PP_3845 in Pseudomonas putida KT2440

Annotation: putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13416: SBP_bac_8" amino acids 45 to 332 (288 residues), 111.1 bits, see alignment E=1.3e-35 PF01547: SBP_bac_1" amino acids 46 to 303 (258 residues), 60.6 bits, see alignment E=3.9e-20 PF13343: SBP_bac_6" amino acids 80 to 321 (242 residues), 45.7 bits, see alignment E=8.8e-16

Best Hits

Swiss-Prot: 49% identical to SPUD_PSEAB: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to ppu:PP_3845)

MetaCyc: 53% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine/putrescine-binding periplasmic protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G80 at UniProt or InterPro

Protein Sequence (369 amino acids)

>PP_3845 putrescine-binding periplasmic protein (Pseudomonas putida KT2440)
MKRIRYMQFALVSLFSFGVVCAEAGDAQKPSVHIYNWYDYIAPNTVKDFQKEAGVSVVYD
VFDNSEVMQSKLMAGRSGYDVVVASADLLPNLIKAGVLKRLDRSKLPNWSHLDPDVLAKL
QSNDPGNSYAAPYLWGTTGIGYDADKVKSLLGPDAPVNSWDLIFKEENLAKLRQCGVAML
DAPGEVIPIALHYLGLPYNSHNPDDYKKAQELLLKLRPHIAYFDSSRFISDLANGNVCVV
LGWAGGVSDAQKASELAGNHRNLVYSIPREGAPVWVESMVQLNDAPNPEQGLAFINYMLR
PEVIAESSNYLSYPNANKDATALVEKKIRDNPGVYPSKDVLSTLFPLEPLPLKLERIRTR
AWNTVKTGN