Protein Info for PP_3839 in Pseudomonas putida KT2440

Annotation: short-chain alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF08240: ADH_N" amino acids 24 to 133 (110 residues), 94.1 bits, see alignment E=8.6e-31 PF00107: ADH_zinc_N" amino acids 172 to 298 (127 residues), 104.3 bits, see alignment E=7.2e-34 PF13602: ADH_zinc_N_2" amino acids 205 to 332 (128 residues), 32.9 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 85% identical to ADHP_ECOLI: Alcohol dehydrogenase, propanol-preferring (adhP) from Escherichia coli (strain K12)

KEGG orthology group: K13953, alcohol dehydrogenase, propanol-preferring [EC: 1.1.1.1] (inferred from 98% identity to ppg:PputGB1_3554)

MetaCyc: 85% identical to ethanol dehydrogenase / alcohol dehydrogenase (Escherichia coli K-12 substr. MG1655)
Alcohol dehydrogenase. [EC: 1.1.1.1]; 1.1.1.1 [EC: 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G86 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PP_3839 short-chain alcohol dehydrogenase (Pseudomonas putida KT2440)
MKAAVVAPGRRVDVIEKSLRPLEHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRDVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNVRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKVIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG