Protein Info for PP_3830 in Pseudomonas putida KT2440

Annotation: Molybdenum import ATP-binding protein ModC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 8 to 361 (354 residues), 444.6 bits, see alignment E=1.4e-137 PF00005: ABC_tran" amino acids 19 to 164 (146 residues), 101.1 bits, see alignment E=7.9e-33 PF03459: TOBE" amino acids 299 to 361 (63 residues), 47 bits, see alignment E=2.4e-16

Best Hits

Swiss-Prot: 100% identical to MODC_PSEPK: Molybdenum import ATP-binding protein ModC (modC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to ppu:PP_3830)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88G95 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PP_3830 Molybdenum import ATP-binding protein ModC (Pseudomonas putida KT2440)
MTASIVAHLKLARDDFTLDVNLHLPGRGISALFGHSGSGKTSCLRCLAGLERAASAYIEV
NGEVWEDSTRGYFQAPHLRPVGYVFQEASLFPHLSVRGNLTFGWRRVAPAERKVSLDQAC
QLLGIGHLLDRRPATLSGGEAQRVGIARALLSSPRLLLMDEPLAALDSPRKREILPFLER
LHDELDIPLIYVSHAQDEVARLADHLVLLEQGRAIASGPIGETLARLDLSLAQGDDAGVV
FEGRVVGHDPHYGLLDLRLPGSSGPLLRITHAAQVMGSTLRVKVQARDVSLALAADSASS
ILNRLPVRVRESCPAANPAHVLVSLDAGGNALLARITRFSADQLGLHTGQILFAQIKSVA
LLG