Protein Info for PP_3802 in Pseudomonas putida KT2440

Annotation: putative Cation ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00005: ABC_tran" amino acids 30 to 170 (141 residues), 85.1 bits, see alignment E=3.8e-28

Best Hits

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to ppu:PP_3802)

Predicted SEED Role

"ABC transporter in pyoverdin gene cluster, ATP-binding component" in subsystem Siderophore Pyoverdine

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GC2 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PP_3802 putative Cation ABC transporter, ATP-binding protein (Pseudomonas putida KT2440)
MTAAAKLATACGPRIDFTGIDLTLGRTRILEQVSFSVAAGSVHAIVGPNGGGKSSLIKTL
LGQMPHQGQLTLHWPGEREVIGYVPQALEFDRGLPMTVDDFMAAMCQRRPAFLGLSRRVK
PAIDAALVQVGMLDKRTRRMGALSGGERQRVLLAQGLIPEPQLLVLDEPMSALDEAGIQV
FEQLLQVWRQAGTTVLWIEHDLEAVLRLADRVTGLNRQVLFDAPPAQALTPERLLGLFSV
HPRSESLA