Protein Info for PP_3763 in Pseudomonas putida KT2440

Annotation: putative CobF protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR02434: precorrin-6A synthase (deacetylating)" amino acids 2 to 247 (246 residues), 377.9 bits, see alignment E=1.2e-117 PF00590: TP_methylase" amino acids 4 to 220 (217 residues), 98 bits, see alignment E=4e-32

Best Hits

Swiss-Prot: 47% identical to COBF_SINSX: Precorrin-6A synthase [deacetylating] (cobF) from Sinorhizobium sp.

KEGG orthology group: K02228, precorrin-6A synthase [EC: 2.1.1.152] (inferred from 100% identity to ppu:PP_3763)

MetaCyc: 47% identical to precorrin-5 (C1)-methyltransferase (Pseudomonas denitrificans (nom. rej.))
Precorrin-6A synthase (deacetylating). [EC: 2.1.1.152]

Predicted SEED Role

"Precorrin-6A synthase (EC 2.1.1.152)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.152)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.152

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GG1 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PP_3763 putative CobF protein (Pseudomonas putida KT2440)
MKDLLLIGIGAGDPRQVTYEAVDALRSASVFFVLDKGDDKDELVRLRKAILQRYRPEGGY
RLVPVVDPLRDAQAQDYLGAVQNWHRQRAALYARLIEEEIGDGETGAFLLWGEPTLYDST
LRILDLVREQGVTLRLQVIPGISSVQALAARHQVPLNRIGEPLTVLPGRRLAEQGAVDNV
VVMLDGQCAFAGLDDPALTIYWGAYLGTEDEVLIAGPLQAVKAQILEVRERERARKGWIM
DTYLLRREL