Protein Info for PP_3753 in Pseudomonas putida KT2440

Annotation: Transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 143 to 160 (18 residues), see Phobius details PF12625: Arabinose_bd" amino acids 26 to 204 (179 residues), 104.2 bits, see alignment E=1.4e-33 PF12833: HTH_18" amino acids 254 to 332 (79 residues), 67 bits, see alignment E=2.3e-22 PF00165: HTH_AraC" amino acids 296 to 330 (35 residues), 38.9 bits, see alignment 1.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3753)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GH1 at UniProt or InterPro

Protein Sequence (362 amino acids)

>PP_3753 Transcriptional regulator, AraC family (Pseudomonas putida KT2440)
MRESDSVAVYFLNAMLHALRDTPAERDAQLLAVGIAPQLLDQPLARVPAKAFAQLWLALI
QRLDDEFFGLDSHGMPLGSFALICRGLILEPNLEKALRQCMGGFGLFLRDLRGSLTVRGG
RAVISVQSNIADPLTRVYAEETYLVLMIGMLCWLAGRRIAIDRTELAVSRPAQEDDLLLW
GPDLRLGSGRTEVEFDSAYLRLPVVQDRAALKTFLRSAPQGLVIRFRNQNGLVAEVYRHL
RALRYGQWPTLAALAQQQGISASTFRRQLEREGRSYQQIKDEVRRAMAFERLREGALSIA
EIAEQAGFQEPSAFHRAFKKWTGQSPGSYRARLVGLRSTCRSGHAREETTAVDGTGSAGV
RG