Protein Info for PP_3748 in Pseudomonas putida KT2440

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF03928: HbpS-like" amino acids 11 to 129 (119 residues), 125.4 bits, see alignment E=7.5e-41

Best Hits

Swiss-Prot: 65% identical to GLCG_ECOLI: Protein GlcG (glcG) from Escherichia coli (strain K12)

KEGG orthology group: K11477, glc operon protein GlcG (inferred from 98% identity to ppf:Pput_2015)

Predicted SEED Role

"Hypothetical protein GlcG in glycolate utilization operon" in subsystem Glycolate, glyoxylate interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GH5 at UniProt or InterPro

Protein Sequence (132 amino acids)

>PP_3748 conserved hypothetical protein (Pseudomonas putida KT2440)
MLSKFVIGQTEIARVLTAARQEAQARQWSVTIAVVDDGGHPLALERLDGCAPASAYIALE
KARTAALGRKETRDYEEMVNGGRTAFVTAPLLTSLEGGVPLRVEGQVVGAIGVSGVKSEQ
DAQVAKAGAAAL