Protein Info for PP_3746 in Pseudomonas putida KT2440

Annotation: glycolate oxidase, putative FAD-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF01565: FAD_binding_4" amino acids 12 to 136 (125 residues), 84.9 bits, see alignment E=2.2e-28

Best Hits

Swiss-Prot: 64% identical to GLCE_ECOLI: Glycolate oxidase subunit GlcE (glcE) from Escherichia coli (strain K12)

KEGG orthology group: K11472, glycolate oxidase FAD binding subunit (inferred from 100% identity to ppu:PP_3746)

MetaCyc: 64% identical to glycolate dehydrogenase, putative FAD-binding subunit (Escherichia coli K-12 substr. MG1655)
Glycolate dehydrogenase. [EC: 1.1.99.14]; 1.1.99.14 [EC: 1.1.99.14]

Predicted SEED Role

"Glycolate dehydrogenase (EC 1.1.99.14), FAD-binding subunit GlcE" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 1.1.99.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.14

Use Curated BLAST to search for 1.1.99.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GH7 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PP_3746 glycolate oxidase, putative FAD-binding subunit (Pseudomonas putida KT2440)
MSMDRDMSQTLLEQVNQALNEGTPLRIQGSNSKAMLGNPVAGEVLDTRKHRGIVSYDPTE
LVLTARAGTPLREIEAALHEAGQMLPCEPPHLGPEATLGGMVAAGLSGPRRPWAGSVRDF
VLGTRVITGHGKLLRFGGEVMKNVAGYDVSRLMAGSFGCLGLLTEVSLKVLPRPRLCLSL
RLAMGRNEALAELAEWGQQSLPISAACHEGETLYLRLEGGEGSVQSARQRLGGDTLDNRF
WSDLREQRLAFFADAAPLWRLSVPTVTGELDLPGQQLLDWGGAQRWLKTCASAQAIRDQV
ARVGGHATCYAPGAASSPPLPVALMRYHRALKQQLDPQGVFNPGRLYPDL