Protein Info for PP_3736 in Pseudomonas putida KT2440

Annotation: vanillate O-demethylase oxygenase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF00355: Rieske" amino acids 6 to 87 (82 residues), 64.9 bits, see alignment E=5e-22 PF19112: VanA_C" amino acids 141 to 338 (198 residues), 173.9 bits, see alignment E=4.4e-55

Best Hits

Swiss-Prot: 78% identical to VANA_PSEUH: Vanillate O-demethylase oxygenase subunit (vanA) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: K03862, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 100% identity to ppu:PP_3736)

MetaCyc: 78% identical to vanillate O-demethylase oxygenase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Vanillate O-demethylase oxygenase subunit (EC 1.14.13.82)" in subsystem Phenylpropanoid compound degradation (EC 1.14.13.82)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.82

Use Curated BLAST to search for 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GI6 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PP_3736 vanillate O-demethylase oxygenase subunit (Pseudomonas putida KT2440)
MYPKNTWYVACTPDEIATKPLGRQICGEKIVFYRARENQVAAVEDFCPHRGAPLSLGYVE
DGNLVCGYHGLVMGCDGKTVSMPGQRVRGFPCNKTFAAVERYGFIWVWPGDQAQADPALI
PHLEWAVSDEWAYGGGLFHIGCDYRLMIDNLMDLTHETYVHASSIGQKEIDEAPPVTTVT
GDEVVTARHMENIMAPPFWRMALRGNGLADDVPVDRWQICRFTPPSHVLIEVGVAHAGKG
GYHAEAQHKASSIVVDFITPESDTSIWYFWGMARNFAAHDQTLTDNIREGQGKIFSEDLE
MLERQQQNLLAHPERNLLKLNIDAGGVQSRKVLERIIAQERAPQPQLIATSANPA