Protein Info for PP_3711 in Pseudomonas putida KT2440

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 TIGR00229: PAS domain S-box protein" amino acids 10 to 132 (123 residues), 57.6 bits, see alignment E=1.4e-19 amino acids 152 to 269 (118 residues), 25.7 bits, see alignment E=1.1e-09 PF00989: PAS" amino acids 10 to 122 (113 residues), 37.9 bits, see alignment E=4.8e-13 amino acids 152 to 261 (110 residues), 27 bits, see alignment E=1.2e-09 PF13426: PAS_9" amino acids 22 to 124 (103 residues), 41.7 bits, see alignment E=3.7e-14 amino acids 162 to 264 (103 residues), 15.7 bits, see alignment E=4.5e-06 PF08448: PAS_4" amino acids 22 to 127 (106 residues), 24 bits, see alignment E=1.1e-08 amino acids 159 to 265 (107 residues), 37.6 bits, see alignment E=6.7e-13 PF13188: PAS_8" amino acids 152 to 195 (44 residues), 22.7 bits, see alignment 2.1e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 273 to 436 (164 residues), 152.3 bits, see alignment E=1e-48 PF00990: GGDEF" amino acids 276 to 433 (158 residues), 171.1 bits, see alignment E=5e-54 PF00563: EAL" amino acids 454 to 502 (49 residues), 50.6 bits, see alignment 5.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3711)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GL0 at UniProt or InterPro

Protein Sequence (503 amino acids)

>PP_3711 diguanylate cyclase (Pseudomonas putida KT2440)
MSLAANPDIMYRLLIQSVVDYAIYLLTPEGIVANWNPGAQRAKGYRAEEIVGQHYSLFYT
DAERAAGLPAFNLEQARSTGRFEETGARLRKDGTAFHAHVVIEAVYDDAGQLVGFAKVTR
DISERHRQELELLQAKELAEQYSQEMAKLSQFLDSVIANIPASVIVQDLESQRILLANQQ
AERLFGGPQHSMIGQLPRECLAPAAGDYLEQQFVRGARSTKGHAAETRVDTARGPRTLRS
RTLLSQNREGQADYVLFVAEDATEELAAHAQIHHMAHHDALTGLPNRTLFHERLRQALLR
GSENAKLTAALCLDLDNFKNINDSLGHAFGDKLLRELGKRLRRELREHDTLARLGGDEFA
VVLTGLEGRDAACNTAQRLIKAISPPFRIEGHQFAVGVSIGIAIAPDDHDQAEQLLGYAD
MALYQAKRNGRNRYECFDVELDVAARQRRLVETDLRTALHLGQLQLHYQPVVDHQTSSVT
GYEALLRWEHPTRGMVMPMDFIF