Protein Info for PP_3700 in Pseudomonas putida KT2440

Annotation: putative ATPases involved in chromosome partitioning

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF10609: ParA" amino acids 73 to 113 (41 residues), 28.5 bits, see alignment 1.5e-10 PF13614: AAA_31" amino acids 74 to 212 (139 residues), 36.2 bits, see alignment E=9.4e-13 PF01656: CbiA" amino acids 76 to 109 (34 residues), 28.2 bits, see alignment 2.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3700)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GM1 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PP_3700 putative ATPases involved in chromosome partitioning (Pseudomonas putida KT2440)
MSPLAAALMSSRIEHSMSRYRAAECAGVSERTWRSYEQGQRRPRRSVVQNFYDRSGIPMP
SDTARLLRVTQTARVISITSLKGGVGKSPITIDVAACLVERGNRVAVITHDCCYEDGVSN
GARPLTGSLAERIDFFGFADVFFCLAEKESFAKRLRHVVDHGTSMDRSGLEFETGGTLGS
MVERIGSSRMFKDIKADYDYILLDLNLKVDLIRTYSDLVAIIIDSTCPQSVDSAQRLNLR
LLKSKGGRRTPKCFGLVTRNDVGGRSRELEAYCEGLDISPEMAEGLEAERLVSSRFRERI
LSDIKSLPLTRLLTHLTNAHEIVIEKYSNDQPFMDGFSYFDSVLDISPDSHAADEIRRLT
AELVDLRL