Protein Info for PP_3681 in Pseudomonas putida KT2440

Annotation: putative Helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF00580: UvrD-helicase" amino acids 16 to 108 (93 residues), 61.7 bits, see alignment E=2.3e-20 amino acids 133 to 218 (86 residues), 59.6 bits, see alignment E=1.1e-19 PF13245: AAA_19" amino acids 28 to 201 (174 residues), 61.9 bits, see alignment E=1.8e-20 PF13361: UvrD_C" amino acids 224 to 401 (178 residues), 35.8 bits, see alignment E=1.6e-12 amino acids 458 to 519 (62 residues), 47.7 bits, see alignment E=3.9e-16 PF13538: UvrD_C_2" amino acids 465 to 515 (51 residues), 34.2 bits, see alignment 4.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3681)

Predicted SEED Role

"ATP-dependent DNA helicase pcrA (EC 3.6.1.-)" in subsystem DNA repair, bacterial UvrD and related helicases (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GN9 at UniProt or InterPro

Protein Sequence (552 amino acids)

>PP_3681 putative Helicase (Pseudomonas putida KT2440)
MISHDQWAPSLGVRLEKNAWSVVRELDRSILLTAGPGAGKTEVLAQRADYLLRTNSCRFP
KRILAVSFKTDASRNLKERIQLRCGWNFASRFDSVTFHGFAKRIIDKFLPILAEEGLSPD
YAIGAETIPGKQITFKQLLPLAIKIIQRSEVARNAIRKTYAHVFLDEFQDCTADQYELIK
LLFLGTGIHLTAVGDRKQMIMGWAGALEGIFKTYATDFDALPLHLYANFRSKSNLLRVQN
EIIREIDPSAVTPAELISGDEGEVLAVHFQHSSQEATVLADSIFHWIEAGVPPREIAVLM
PRQVDDYGSALMAELGNRGIASRNDSDLQDLLKEPAARLVIDYLTCLYGKGQSDAWARLM
DLFTPYEEASRDHLHRLFETTYRAHVRQVKVASKTPSPYEDWWKLTSSFIRDVGYPILTA
LSGDYESKLRLHEVVREVRDRVGALLSSEKTIPGALARLSDDQAVRFLTIHKSKGLEFHT
VIILGVETQAFWGKLAEERCVYFVGVSRAKERLLITTAEYRPKPKNAGRWTEHRTPHGEF
VSQVTRHLTGRL