Protein Info for PP_3667 in Pseudomonas putida KT2440

Annotation: Creatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF01321: Creatinase_N" amino acids 27 to 158 (132 residues), 59.7 bits, see alignment E=4.5e-20 PF00557: Peptidase_M24" amino acids 166 to 382 (217 residues), 110 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 86% identical to CREA_FLASU: Creatinase from Flavobacterium sp. (strain U-188)

KEGG orthology group: K08688, creatinase [EC: 3.5.3.3] (inferred from 100% identity to ppf:Pput_2062)

MetaCyc: 63% identical to creatinase (Arthrobacter sp. TE1826)
Creatinase. [EC: 3.5.3.3]

Predicted SEED Role

"Creatinase (EC 3.5.3.3)" (EC 3.5.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GQ1 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PP_3667 Creatinase (Pseudomonas putida KT2440)
MQMPKTLKIRNGDKVQPTFSAQEYAARHARLRAYMAEQDIEAAIFTSYHNVNYYSDFLYC
SFGRPYALVITQDKVVSISANIDGGQPWRRTVGTDNIVYTDWQRDNYFVAIQQALPLASR
IGVEYDHLNLQNHGKLAACYPKAELVDIAAPCMRMRMIKSAEEQALIRHGAQVADIGGAA
VVEALREQVPEYEVALHATQAMVREIAKRFPDAELMDTWTWFQSGLNTDGAHNPVTSRRV
GKGEILSLNCFPMIAGYYTALERTLFLDHCPDEYLRLWQANVEVHEAGLQLVRPGMRCSD
IARELNEIFLRHDLLQYRTFGYGHSFGTLSHYYGREAGLELREDIDTVLEPGMVVSIEPM
IMLPEGRPGAGGYREHDILIVNDSGAENITKFPYGPEHNIIRK