Protein Info for PP_3666 in Pseudomonas putida KT2440

Annotation: Metabolite MFS transporter, MHS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 384 to 407 (24 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 29 to 238 (210 residues), 97.9 bits, see alignment E=6.5e-32 amino acids 237 to 443 (207 residues), 54.1 bits, see alignment E=1.3e-18 PF07690: MFS_1" amino acids 32 to 301 (270 residues), 94.2 bits, see alignment E=8e-31 amino acids 264 to 432 (169 residues), 48.5 bits, see alignment E=6.2e-17

Best Hits

Swiss-Prot: 40% identical to OUSA_DICD3: Glycine betaine/proline/ectoine/pipecolic acid transporter OusA (ousA) from Dickeya dadantii (strain 3937)

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to ppf:Pput_2063)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GQ2 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PP_3666 Metabolite MFS transporter, MHS family (Pseudomonas putida KT2440)
MSSTTLDPSAIAGPAHNAERQALRKAARASFMGNFVEWFDYAAYGYLATIIAATFFPQTD
KTTGLLATFAVFALSFLVRPLGGIVWGHFGDRHGRRNALSWSILIMSVSTFCIGLLPGYA
QIGLWAPALLLLIRLVQGFSASGEYAGAAAFLAEYAPPGRRGLYTSIVPASTAAGLLFGA
AFVAVLHELLSSEALHEWGWRLPFLLAAPFGLVGRYIRMSLQDTPKFLEMEQRLETKAGM
ATTPLRELLGQHRRSLAIGMGVTCLNAVAFYLLLSYMPTYLSSEMGMSERDSFIASTVSL
ATYIGLIFLMGRLSDQFGRKTMLVVASLLFLGLTVPLFRLLDGQPLLVILAIQILFGAML
AMNDGTLPCLLAEIFPTRVRFSGFALSFNVANALFGGTAPFIATWLIQVTGSKLAPAGYL
LAAALVALVAMLMCRETAHAALED