Protein Info for PP_3637 in Pseudomonas putida KT2440

Annotation: putative Sulfonate ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00005: ABC_tran" amino acids 27 to 167 (141 residues), 108.3 bits, see alignment E=2.5e-35

Best Hits

Swiss-Prot: 46% identical to SSUB2_BURL3: Aliphatic sulfonates import ATP-binding protein SsuB 2 (ssuB2) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to ppu:PP_3637)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GT1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PP_3637 putative Sulfonate ABC transporter, ATP-binding protein (Pseudomonas putida KT2440)
MSAVLLEARDIRLGYPREGGWQQVLAQFDLQLAPGEVVSILGPSGVGKSSLLRVLAGLQQ
PGGGSVSLHGQPLQGPHPRLAVAFQDPSLLPWLSLEKNVAFGLDFARQPRLADAERRARI
DHAIEAVGLAHARGQYPAQLSGGMAQRTALARCLARQPEVLLLDEPFGALDEVTRADMQQ
LLLQLIATHKTAAVLITHDIDEALLLSDRVLLLGNLPAHILGQWHIDLPQPRTQRVEELG
ALRIEILKTLRRASRTVEPTPTSLPSEAVHVHG