Protein Info for PP_3636 in Pseudomonas putida KT2440

Annotation: putative Sulfonate ABC transporter, periplasmic sulfonate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 11 to 29 (19 residues), 18.8 bits, see alignment (E = 7.8e-08) PF10518: TAT_signal" amino acids 11 to 29 (19 residues), 25.4 bits, see alignment (E = 1.5e-09) PF13379: NMT1_2" amino acids 40 to 277 (238 residues), 158.8 bits, see alignment E=3.4e-50 PF09084: NMT1" amino acids 54 to 276 (223 residues), 23.3 bits, see alignment E=8.3e-09

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ppu:PP_3636)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GT2 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PP_3636 putative Sulfonate ABC transporter, periplasmic sulfonate-binding protein (Pseudomonas putida KT2440)
MCMDDCCSSSSRRDFLKLGAMLTAAGALPLLSSLQARAAAEPDAPVRIGYLPITDATPLL
VAHNNGLFEAEGIKAERPVLLRSWAQVIEAFISGQVNVIHLLSPMTVWARYGSKVPAKVV
AWNHVGGSGLTVAPDISAVKQLGGKTVAIPFWYSIHNVVLQQLLNDNGLTPVSKPANAQL
AANEVNLLVLPPSDMPPALASKRIAGYIVAEPFNALAENLKVGRVQRFTGDVWRNHACCV
VFMHEHDLNNRPEWSQKVVNAIVKAQQWTRDHRTEAAALLSRAGPNKYTPHEPAVLTKVL
APAAEDRAGYIASGAIRHQQWDEKRIDFQPYPFPSYTEELVKRLKTTLIEGDNTFLSGLD
PAYAARDLVDDRFVRNAIATVGGPSVFGIADNFERSEEFAV