Protein Info for PP_3623 in Pseudomonas putida KT2440

Updated annotation (from data): vanillin dehydrogenase, cytochrome c component
Rationale: Specifically important in carbon source Vanillin. This gene cluster is probably the major vanillin dehydrogenase in P. putida. This system is expected to use a molybdopterin cofactor, which explains why molybdate uptake is required for growth on vanillin (PMID:24136472).
Original annotation: Alcohol dehydrogenase cytochrome c subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00034: Cytochrom_C" amino acids 206 to 304 (99 residues), 26 bits, see alignment E=2e-09 amino acids 330 to 415 (86 residues), 53 bits, see alignment E=7.6e-18 PF13442: Cytochrome_CBB3" amino acids 329 to 411 (83 residues), 36.5 bits, see alignment E=5.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3623)

Predicted SEED Role

"Putative diheme cytochrome c-553" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GU4 at UniProt or InterPro

Protein Sequence (447 amino acids)

>PP_3623 vanillin dehydrogenase, cytochrome c component (Pseudomonas putida KT2440)
MTHRFARTAGWLALPCLVAAGLLAWYVTREPASPFADAQATAADPALVSRGEYVARLSDC
VACHSLPGGKPFAGGLEMATPLGAIHATNITPDRDSGIGNYTLADFDRAVRQGVAPGGRR
LYPAMPYPSYAKLSDDDVKALYAFFMHGVQPARQANLGSDIPWPLNLRWPIALWNGLFAA
TTPYTDKAGQDAQWNRGAYIVQGPGHCGSCHTPRGLAFNEKALDDSGKPFLSGALLDGWY
APSLRADHNTGLGRWSEAEIAQFLKTGRNRHAVVYGSMTEAFNNSTQFMHDDDLAAIAHY
LKSLPGDPQRDGAPWHYQAESLATRLDSPGARTYVTRCASCHGLDGKGQAEWMPPLAGAT
SALAKESASAINITLNGSQRVVAAGVPDAYRMPALREQLSDQEIADVLSFVRTAWGNQGG
AVDAQAVGKLRGHTDPASSSPIILHMR