Protein Info for PP_3606 in Pseudomonas putida KT2440

Annotation: quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF08240: ADH_N" amino acids 27 to 109 (83 residues), 48.6 bits, see alignment E=1.3e-16 PF00107: ADH_zinc_N" amino acids 151 to 253 (103 residues), 66.8 bits, see alignment E=2.8e-22 PF13602: ADH_zinc_N_2" amino acids 184 to 322 (139 residues), 64.5 bits, see alignment E=2.9e-21

Best Hits

Swiss-Prot: 44% identical to CAA43_BURSP: 2-haloacrylate reductase (caa43) from Burkholderia sp.

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to ppu:PP_3606)

MetaCyc: 44% identical to 2-haloacrylate reductase (Burkholderia sp. WS)
RXN-14536 [EC: 1.3.1.103]

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.3.1.103 or 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GW1 at UniProt or InterPro

Protein Sequence (324 amino acids)

>PP_3606 quinone oxidoreductase (Pseudomonas putida KT2440)
MATRIILNSTGAADVMQLEHVAAQSPGPGQVWLEQTAMGVNPLDVLQRKGGAALALPSGL
GLEGAGRVSAIGDGVHNVQVGDRVAYAMGPVGAYASGRLFPAERLVPLPPQLEDEAAAAV
LFKGITAQYLLKTTYAVGPGTQVLLYGAAGALGQLMVPWARHLGATVIGVVSRLQSVERA
RAAGCQHVLVFDAKTLASQVRELTQGQGVAVVYDCVGKVSLEASLGSLRVRGLLVSFGGT
SGAPPAIEVATLNANGSLYLTRPSLAAHTRTVEEYQQRAADVLAAVAEGIVQPRVWRCFP
LAEAAKAHECLEQGRSEGALVLTA