Protein Info for PP_3599 in Pseudomonas putida KT2440

Updated annotation (from data): 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)
Rationale: Specifically important for utilizing D-Glucuronic Acid. Automated validation from mutant phenotype: the predicted function (4.2.1.41) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: 5-dehydro-4-deoxyglucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03249: 5-dehydro-4-deoxyglucarate dehydratase
  • amino acids 3 to 300 (298 residues), 442.4 bits, E=3.6e-137
• PF00701: DHDPS
  • amino acids 12 to 298 (287 residues), 176 bits, E=3.7e-56

Best Hits

Swiss-Prot: 100% identical to KDGD_PSEPK: 5-dehydro-4-deoxyglucarate dehydratase (PP_3599) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01707, 5-dehydro-4-deoxyglucarate dehydratase [EC: 4.2.1.41] (inferred from 99% identity to ppg:PputGB1_2317)

MetaCyc: 69% identical to 5-dehydro-4-deoxyglucarate dehydratase subunit (Acinetobacter baylyi ADP1)
5-dehydro-4-deoxyglucarate dehydratase. [EC: 4.2.1.41]

Predicted SEED Role

"5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.41)

MetaCyc Pathways

• D-galactarate degradation II (3/3 steps found)
• D-glucarate degradation II (3/3 steps found)
• D-glucuronate degradation II (4/5 steps found)
• D-galacturonate degradation II (3/5 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.41

Sequence Analysis Tools

See Q88GW8 at UniProt or InterPro

Protein Sequence (303 amino acids)

>PP_3599 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (Pseudomonas putida KT2440)
MNPQELKSILSHGLLSFPVTDFNAQGDFNPAGYIKRLEWLAPYGASALFAAGGTGEFFSL
AASEYSQVIKTAVDTCATSVPILAGVGGSTRQAIEYAQEAERLGAKGLLLLPHYLTEASQ
DGVAAHVEAVCKSVNIGVVVYNRNVCRLNADLLEKLAERCPNLIGYKDGLGDIELMVSIR
RRLGERFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFVPKTAMDFYNAIARDDHATVAK
LIDDFFLPYLDIRNRKAGYAVSIVKAGARIAGYDAGPVRTPLTDLTAEEYEMLAALMDKM
GPQ