Protein Info for PP_3597 in Pseudomonas putida KT2440

Updated annotation (from data): L-lysine and D-lysine ABC transporter, ATPase component
Rationale: Specifically important for utilization of L-lysine and D-lysine.
Original annotation: Amino-acid ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00005: ABC_tran" amino acids 36 to 184 (149 residues), 138.1 bits, see alignment E=3.1e-44 PF13304: AAA_21" amino acids 154 to 215 (62 residues), 28.2 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 64% identical to YHDZ_ECOLI: Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ (yhdZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_2175)

MetaCyc: 58% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GX0 at UniProt or InterPro

Protein Sequence (260 amino acids)

>PP_3597 L-lysine and D-lysine ABC transporter, ATPase component (Pseudomonas putida KT2440)
MTAPLSLATLAPEPDPRPVLIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKS
TLIRCINRLEVAQQGSIQVDGIDLAATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLA
PTSVRGLSRKDAEERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFD
EPTSALDPEMVAEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQ
VFFNQPRTERAKAFLAQILH