Protein Info for PP_3594 in Pseudomonas putida KT2440

Updated annotation (from data): L-lysine and D-lysine ABC transporter, permease component 1
Rationale: Specifically important for utilization of L-lysine and D-lysine.
Original annotation: Amino acid ABC transporter, membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 100 to 126 (27 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 18 to 123 (106 residues), 47.4 bits, see alignment E=1.1e-16 PF00528: BPD_transp_1" amino acids 37 to 229 (193 residues), 70.9 bits, see alignment E=5.9e-24

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to ppg:PputGB1_2322)

Predicted SEED Role

"Arginine transport system permease protein ArtQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GX3 at UniProt or InterPro

Protein Sequence (239 amino acids)

>PP_3594 L-lysine and D-lysine ABC transporter, permease component 1 (Pseudomonas putida KT2440)
MLDQLSLLSFASGGWGQALLAGALVTVSLALACLPIGLPLGLVVALAARSRKRLPRAWAT
TFSTVFRGLPELLTLLIIYYGCQIAAQKILAAMGYQGEFLINTFLAAMIAFSLVFAAFSS
EIWLAAFKTLPKGQLEACSALGLSKRTGFFKVLLPQLTRIALPGLSNNWLSLLKDTSLVS
TISLVDLMRQTNLAVSVTKEPMFFYGVACLGYLLFAALSGRVFAYIERRSNRHLQGARA