Protein Info for PP_3557 in Pseudomonas putida KT2440

Annotation: Methyl-accepting chemotaxis transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 112 to 246 (135 residues), 34.1 bits, see alignment E=5.1e-12 PF00672: HAMP" amino acids 380 to 433 (54 residues), 37.8 bits, see alignment 3e-13 PF00015: MCPsignal" amino acids 525 to 681 (157 residues), 155.9 bits, see alignment E=1.4e-49

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ppu:PP_3557)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H08 at UniProt or InterPro

Protein Sequence (714 amino acids)

>PP_3557 Methyl-accepting chemotaxis transducer (Pseudomonas putida KT2440)
MPLRQLSIQWKITLLAGLCLAAIVTLLVGLSLYRMDHSSDLVKASSMQMLTEAAQSRIES
QGEVQALNIRRQFMDAYQYGAGFARQVLFLREQAEKRFLDAFDLREDMTRQVRAALQANP
DLLGLSLVFEPNALDNKDSLFAGKAELGSNETGRFALYWSQPRAGQLTSMALPEHDMANT
EIGPSGQPANTWWVCPRTSGKVCVVEPYFYDIDGQQVLMTSIVFPLAVNGKIIATLSIDI
NLNSLQALSQEASRSLYEGRTTVGILTPVGLLAGYSADASKLAQRFDQVDPTKGAELVRK
LADGKLTTLHDRQRLKVLAAFRPIPDAQPWGVLLDVPENALTGPAETLKQELDALNTSGT
LLELSLGLAAAIVGLLLVWLMARGVTRPILGVAAMLKDIASGEGDLTRRLTYQKQDELGE
LAGWFNRFLDKLQPTIAEVKRSVQAARGTADQSSAIATETSAGMEQQYRQVDQVATASHE
MSATAQDVARSAAQAAQAARDADQATREGLAVIDRTTSSIGALAANMSDTMAEIEGLAQN
SEKIGSVLEVIRSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAQRTQESVEET
RQVIEALQNGTREVVGAMDHSHRQAQGGVEQVGQAVTALQRIGQAVTVITDMNLQIASAA
EEQSAVAEEINSNVATIRDVTESLSGQANESARVSQSLNSLANQQQALMDQFRV