Protein Info for PP_3554 in Pseudomonas putida KT2440

Annotation: Acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 515 to 532 (18 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 42 to 158 (117 residues), 44.9 bits, see alignment E=3.6e-15 PF02770: Acyl-CoA_dh_M" amino acids 164 to 272 (109 residues), 44.8 bits, see alignment E=2.8e-15 PF00441: Acyl-CoA_dh_1" amino acids 283 to 451 (169 residues), 64.3 bits, see alignment E=3.5e-21 PF22924: ACOX_C_alpha1" amino acids 292 to 447 (156 residues), 28.2 bits, see alignment E=3.9e-10 PF12806: Acyl-CoA_dh_C" amino acids 469 to 584 (116 residues), 93.1 bits, see alignment E=3.6e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3554)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H11 at UniProt or InterPro

Protein Sequence (589 amino acids)

>PP_3554 Acyl-CoA dehydrogenase family protein (Pseudomonas putida KT2440)
MTTYSAPLRDMRFVLHDVFNASGLWARLPALAERIDADTADAILEEASKVTGQLIAPLSR
NGDEQGVCFDAGQVTTPEGFREAWNTYREGGWVGLGGNPEYGGMGMPKMLGVLFEEMLYA
ADCSFSLYSALSAGSCLAIDAHASEALKATYLPPLYEGRWAGTMCLTEPHAGTDLGLIRT
RAEPQADGSVRISGSKIFITGGEQDLTENIVHLVLAKMPDAPAGAKGISLFLVPKFLVEA
DGRLGARNAVHCGSIEHKMGIKASATCVMNFDGAIGYLVGEPNKGLTAMFTMMNYERLSI
GIQGIGCAEASYQSAARYANERLQSRAATGPQAHDKAADPIIHHGDVRRMLLTMRTLTEA
GRAFAVYVGQQLDVARYAEDAGEREHAQRLVALLTPVAKAFFTDNGLESCVLGQQVYGGH
GYIREWGQEQRVRDVRIAQIYEGTNGIQALDLLGRKVLADGGQALASFASEVRAFSVDAP
LHREALQASLARLEATSSWLRAQAGEDANLVSAVAVEYLQLFGLTAYAYMWARMAAVALA
KRDEDDAFHGAKLACAAFYFQRVLPRGLGLEASIRAGSGSLYGLEATQF