Protein Info for PP_3547 in Pseudomonas putida KT2440

Annotation: putative NAD(P)-binding oxidoreductase with NAD(P)-binding Rossmann-fold domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00106: adh_short" amino acids 68 to 260 (193 residues), 157 bits, see alignment E=6.7e-50 PF08659: KR" amino acids 70 to 233 (164 residues), 47.3 bits, see alignment E=3.5e-16 PF13561: adh_short_C2" amino acids 77 to 312 (236 residues), 173.3 bits, see alignment E=9.6e-55

Best Hits

KEGG orthology group: None (inferred from 87% identity to pen:PSEEN2990)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H18 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PP_3547 putative NAD(P)-binding oxidoreductase with NAD(P)-binding Rossmann-fold domain (Pseudomonas putida KT2440)
MPVTCLRKACVRPPEVAKIKIKIKIKSQIKSQIKSRGLAVLMFVIPTQRDFAYCRCSLPQ
TIGKPMENVIVITGGSRGIGAATALLAARQGYRICINYHADDQAAEAILSQVRALGAEAI
AVRADVSVEDEIIQLFLRVDDELGPVTALVNNAGTIGQQSRVEDMSEFRLLNVMKTNVVG
PMLCAKHALLRMARRHGGQGGAIVNVSSVAARLGSPNEYVDYAASKGALDTFTIGLAKEV
AGEGVRVNGVRPGYIHTGFHALSGDPDRVSKLEPGLPMGRGGRPEEVAEAILWLLSDKAS
YATGSLIDLGGGR