Protein Info for PP_3528 in Pseudomonas putida KT2440

Annotation: putative ABC transporter, periplasmic substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF04069: OpuAC" amino acids 40 to 248 (209 residues), 52.1 bits, see alignment E=1.5e-17 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 41 to 321 (281 residues), 192.4 bits, see alignment E=5.1e-61 PF12974: Phosphonate-bd" amino acids 62 to 207 (146 residues), 42.1 bits, see alignment E=1.4e-14 PF13379: NMT1_2" amino acids 62 to 260 (199 residues), 42.6 bits, see alignment E=1.4e-14 PF09084: NMT1" amino acids 67 to 260 (194 residues), 54.1 bits, see alignment E=4.3e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ppu:PP_3528)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H37 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PP_3528 putative ABC transporter, periplasmic substrate-binding protein (Pseudomonas putida KT2440)
MPMPKHAFSPLRRLLIGGLLASVASALLPWSEAIADDARTLRIGYQKFNSINILKGSGAL
EKALAPQGVKVSWHEFAAGPQLLEALSTGAIDLGHAADAPSVFAQAAGKPVVYLAAEQPY
PRGIGLVVREQDHLASVQDLKGKRVATGRGWNAQYLLAVALQQAGLSYKDITPAYVNNAA
DAVAALQSGSVQAVTLWDPFLAAAESQPGLKNLRDGSGLSNNRTFYLSTASFADQHRALL
KTFFAELGKVSQWANAKPAEVAALLAPQLGISTQVLEVASERRNYNAVAITPQIVAEQQK
LADTFQGLGLIPRKLQVAEAVYPASVLP