Protein Info for PP_3521 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details PF00892: EamA" amino acids 156 to 286 (131 residues), 66.3 bits, see alignment E=1.8e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3521)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H44 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PP_3521 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MSTGTTTLTDRKTSAWLWPALFSLVAFAANSVFCRLALKDGAIDPVSFTAVRLASGALFL
LLLIRLRSPVHTMGGSWWGGLALFLYAFLFSAAYLQLGAGVGALLLFGAVQITMFGFAWY
RGEHITVRMLLGMLIAFTGLLVLLLPGVSAPPLASALLMALSGVAWGVYTLLGKGSPRPL
ADTVGNFARSLPCLVLLLPMLLLGAGPHLTPLGLLYALGSGVLASGAGYAVWYGVVRQIS
AQQAATLQLSVPLIAALGGVALIGEPVSLRLLIACVVVLGGIALALAPRR