Protein Info for PP_3506 in Pseudomonas putida KT2440

Annotation: Magnesium chelatase, subunit ChII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF07728: AAA_5" amino acids 33 to 163 (131 residues), 48.1 bits, see alignment E=3.1e-16 PF00493: MCM" amino acids 34 to 156 (123 residues), 31.5 bits, see alignment E=2.4e-11 PF00158: Sigma54_activat" amino acids 34 to 149 (116 residues), 26.3 bits, see alignment E=1.4e-09 PF01078: Mg_chelatase" amino acids 81 to 151 (71 residues), 28.4 bits, see alignment E=2.7e-10 PF17863: AAA_lid_2" amino acids 230 to 297 (68 residues), 63.6 bits, see alignment E=2.9e-21

Best Hits

KEGG orthology group: K03405, magnesium chelatase subunit I [EC: 6.6.1.1] (inferred from 99% identity to ppf:Pput_2270)

Predicted SEED Role

"ChlI component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H59 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PP_3506 Magnesium chelatase, subunit ChII (Pseudomonas putida KT2440)
MSEPVQFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLADLLGEGPF
VTLPLGASEERLVGTLDLDAALGQGKAQFSPGVLAQADGGVLYVDEVNLLPDTLVDLLLD
VAASGTNRIERDGISHRHSARFVLIGTMNPEEGELRPQLLDRFGLNVALEGLPEPEARQQ
IIRRRLAFDNDPQAFCAHWAQAQAQLRERCHAARQALADIALDDQALAWITERCYAAGVD
GLRADLVWLRAARAHCAWRGAAAIEEVDVEAVAEFALRHRRRMTPQASPPSAPQPPDQQP
GAGNPGERGGQGDWGALPAQPVASGARREVPNWAKKP