Protein Info for PP_3466 in Pseudomonas putida KT2440

Annotation: putative ABC efflux transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 281 to 308 (28 residues), see Phobius details PF00664: ABC_membrane" amino acids 29 to 298 (270 residues), 146.1 bits, see alignment E=1.8e-46 PF00005: ABC_tran" amino acids 361 to 510 (150 residues), 106 bits, see alignment E=2.5e-34

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to ppu:PP_3466)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H94 at UniProt or InterPro

Protein Sequence (569 amino acids)

>PP_3466 putative ABC efflux transporter, permease/ATP-binding protein (Pseudomonas putida KT2440)
MDSSDPVLMRQALAWLYGFVRPHRRAIGLLLSLSLGASLLALAQPWLVKTLIDEGLLAKD
YQTLWHMAAIMIGAGLLGTVLAGVNRYLHTRLSGRILFALRDDLYRHLQQLSPTFYGRRR
IGDILSRLDGDVAEIQRFAVDSLFSAVSAVIGLVGAVTLMLMLSWQLSLLLALLVPIEVL
WLRWMRRKVEREVRNLRERSADVSSFLVETLPAMKFIQAAGQQGREAGRLDQLGQGYMRQ
LLKVQVTEFFTQAIPGTLTSWCRACAFLVGGWWVIQGTWQLGALIAFSTYMGMAVGPVQS
LLGLYVAVQRMAVSLGRVMELKQEAVAVHQTANPQPIPDGPGELRLEALSFAHEGRQGAV
LNNVQVSIPGGLKVAISGASGVGKSTLIDLLQRFYDPDAGRILLDGVDLRDLDLAALRRR
IAVVSQDIVLFRGTLAQNLAYGVPEASRDELERVVRLARLDSLVDSLPLGLDGLLGERGQ
QLSGGQKQRIAIARAVLQAPAILVLDEATSAVDEATEREVIAAIDQLFAGRTRILISHRA
STLADADLQLQLHDGQLQVLAQEVIKHGH