Protein Info for PP_3454 in Pseudomonas putida KT2440

Annotation: putative transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00072: Response_reg" amino acids 4 to 114 (111 residues), 105.3 bits, see alignment E=2.1e-34 PF00486: Trans_reg_C" amino acids 150 to 226 (77 residues), 82.6 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 40% identical to OMPR_ECOLI: Transcriptional regulatory protein OmpR (ompR) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 99% identity to ppg:PputGB1_2483)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HA6 at UniProt or InterPro

Protein Sequence (233 amino acids)

>PP_3454 putative transcriptional regulatory protein (Pseudomonas putida KT2440)
MPNIFLVEDDSALSELIASYLQRNDFHVQVIARGDHVLDEYRRQRPDLVILDLMLPGIDG
LQLCRLLRQESQTLPILMLTARDDSHDQVLGLEMGADDYVTKPCEPRVLLARVRTLLRRS
SVNEPRLDNDLILIGGLRIDLAERTVSWRGEEVELSSGEYNLLVVLARNAGEVMNRDRIL
QQLRGIEFNGTDRSVDVAISKLRRKFDDNAGEARKIKTVWGKGYLFSRVEWEC