Protein Info for PP_3446 in Pseudomonas putida KT2440

Annotation: threonine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 195 to 216 (22 residues), see Phobius details TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 31 to 529 (499 residues), 779.3 bits, see alignment E=7.4e-239 PF00291: PALP" amino acids 45 to 332 (288 residues), 281.4 bits, see alignment E=8.9e-88 PF00585: Thr_dehydrat_C" amino acids 345 to 435 (91 residues), 81.6 bits, see alignment E=3.1e-27 amino acids 445 to 529 (85 residues), 78.9 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 53% identical to ILVA_PASMU: L-threonine dehydratase biosynthetic IlvA (ilvA) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to ppu:PP_3446)

MetaCyc: 56% identical to threonine deaminase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HB4 at UniProt or InterPro

Protein Sequence (530 amino acids)

>PP_3446 threonine deaminase (Pseudomonas putida KT2440)
MGNVKIAKESSMTSFSVPRTTVTPQQLLSEQVRRILAAPVYDLAIETPLQAAPALSAALG
NQVLLKREDLQPTFSFKIRGAYTRLSRLTDVQRERGVITASAGNHAQGVALAASHLGMKA
TIVMPTTTPSLKVEGVRSRGGHVVLHGESFPHALTHALKLADSEGATFVPPFDDPDVIAG
QGTVAMEILRQRPGALDAIFVPVGGGGLIAGIAAYVKYLRPDVKVIGVEPADSNCLQAAM
AVGERVILPQVGTFADGVAVAQIGAHCFELCRHFVDEVVTVSSDELCAAIKDIYDDTRSI
TEPSGALAVAGIKKYVAREGVQGQTLVAIDSGANVNFDRLRHVAERAELGEQREAIIAVT
IPEQPGSFRAFCHALGKRQITEFNYRFYPGKEARLFVGVQTHPVHDPREQLLASLREQGY
SVLDLTDNELAKLHVRHTVGGHAASGADERVLRFEFPERPGALLGFLERLGKRWNISLFH
YRNHGAAEARVFAALEVPADELAGLPSTLDEMGYRYWDETDNPAYKLFLG