Protein Info for PP_3423 in Pseudomonas putida KT2440

Annotation: Type II secretion pathway protein XcpT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details PF07963: N_methyl" amino acids 34 to 58 (25 residues), 36.3 bits, see alignment 2.9e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 36 to 59 (24 residues), 33.2 bits, see alignment 3.1e-12 TIGR01710: type II secretion system protein G" amino acids 37 to 169 (133 residues), 194.7 bits, see alignment E=6e-62 PF08334: T2SSG" amino acids 62 to 168 (107 residues), 144.4 bits, see alignment E=1.2e-46

Best Hits

Swiss-Prot: 43% identical to GSPG_PSEAE: Type II secretion system protein G (xcpT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 100% identity to ppu:PP_3423)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HD7 at UniProt or InterPro

Protein Sequence (169 amino acids)

>PP_3423 Type II secretion pathway protein XcpT (Pseudomonas putida KT2440)
MAQGPEADVHGCCMVHVNACPHAVEGFTMQRRTNPQRGFTLLELLVVLVVLGLLAGIVAP
KYFSQLGRSEAKVARAQIEGLSKALDLYRLEVGHYPNSEQGLQALVVAPSGEARWTGPYL
QKAVPQDPWGRPYIYRQPGENGGEYDLLSMGKDGQPGGDGENAEVTSWQ