Protein Info for PP_3408 in Pseudomonas putida KT2440

Annotation: cobalt transporter subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 75 to 95 (21 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details TIGR02458: cobalt transporter subunit CbtA (proposed)" amino acids 1 to 224 (224 residues), 277.9 bits, see alignment E=3.2e-87 PF09490: CbtA" amino acids 4 to 222 (219 residues), 185.7 bits, see alignment E=6.6e-59

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_2354)

Predicted SEED Role

"Predicted cobalt transporter CbtA" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWF2 at UniProt or InterPro

Protein Sequence (228 amino acids)

>PP_3408 cobalt transporter subunit A (Pseudomonas putida KT2440)
MITRIARTAGFSGLLAALLLTLLQSFWVAPLILEAETYESSAPAVHHEHGSEVAAHEHSA
EAWSPEDGWQRVLSTTGGNLVVAVGFALILAALYSLREPKRAATGALWGLAGFAVFCLAP
TLGLPPELPGTAAADLGQRQTWWVGTASATALGLALLVFARHWLLKALGAVLLVIPHVIG
APQPEVHESLAPEALETQFKVASWLTNAAFWLALGLLSAWLFRRSSQA