Protein Info for PP_3406 in Pseudomonas putida KT2440

Annotation: Acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF13302: Acetyltransf_3" amino acids 3 to 137 (135 residues), 26.2 bits, see alignment E=3e-09 PF13673: Acetyltransf_10" amino acids 33 to 138 (106 residues), 34.9 bits, see alignment E=3.4e-12 PF00583: Acetyltransf_1" amino acids 40 to 136 (97 residues), 76.2 bits, see alignment E=6.5e-25 PF13508: Acetyltransf_7" amino acids 53 to 136 (84 residues), 53.4 bits, see alignment E=6.8e-18 PF08445: FR47" amino acids 80 to 143 (64 residues), 29.2 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 41% identical to ATS1_SCHPO: N-acetyltransferase ats1 (ats1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3406)

Predicted SEED Role

"GCN5-related N-acetyltransferase (EC 2.3.1.57)" (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HF3 at UniProt or InterPro

Protein Sequence (159 amino acids)

>PP_3406 Acetyltransferase, GNAT family (Pseudomonas putida KT2440)
MSLTFRPAVRTDAEQILTFITELAEYERARHEVVATLADIEHSLFDEGSTVHALMCERDG
RAIGFAVYFYSYSTWLGRNGIYLEDLYVTPEHRGDGAGRQLLQHIAREAVANNCGRLEWS
VLDWNEPAIGFYQKLGAEAQDEWVRYRLDGDKLAAFARG