Protein Info for PP_3398 in Pseudomonas putida KT2440

Annotation: putative Curli fiber surface-exposed nucleator CsgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07012: Curlin_rpt" amino acids 73 to 102 (30 residues), 30.2 bits, see alignment 1.8e-11 amino acids 96 to 124 (29 residues), 31 bits, see alignment 9.6e-12 amino acids 102 to 135 (34 residues), 40 bits, see alignment 1.5e-14 amino acids 124 to 156 (33 residues), 29.9 bits, see alignment 2.2e-11

Best Hits

KEGG orthology group: K04335, minor curlin subunit (inferred from 100% identity to ppu:PP_3398)

Predicted SEED Role

"Minor curlin subunit CsgB, nucleation component of curlin monomers" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HG0 at UniProt or InterPro

Protein Sequence (157 amino acids)

>PP_3398 putative Curli fiber surface-exposed nucleator CsgB (Pseudomonas putida KT2440)
MKRLYSLLLCLALAGQACWAEDLMDNADLAPGNDLGEPVIIRLLPAGAGQAAVIEQQGLG
NRAALDQNGQALLGRIVQSGGAQEAYILQEGSDLMAIISQQGNGNSASIRQSGSSNNAAI
EQIGNDNSASIVQSGSGLNSSVTQAGNGQHVQITQYR