Protein Info for PP_3377 in Pseudomonas putida KT2440

Annotation: 2-ketogluconate transporter, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 375 (358 residues), 191.6 bits, see alignment E=9.5e-61 amino acids 258 to 410 (153 residues), 45.5 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_2381)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HI0 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PP_3377 2-ketogluconate transporter, putative (Pseudomonas putida KT2440)
MQSQSLAPRRWWYIIPIVFVTYSLAYLDRANYGFAAASGMAEDLHITPVLSSLLGALFFL
GYFFFQVPGAIYAEKRSVKKLIFVCLILWGGLATLTGMVSNVYMLIGIRFLLGVVEAAVM
PAMLVYLCHWFTRAERSRANTFLMLGNPVTILWMSVVSGYLIKHYDWRWMFIIEGLPAVI
WAFFWWRLVDDRPAQVAWLSEQEKAALAQALAAEQQGIKPVKNYREAFRSPQVIILALQY
FCWSIGVYGFVLWLPSILKQAANVDIVQAGWLASVPYLAAVLAMVGVSWASDRLQKRKRF
VWPPLLIAALAFYGSYALGSEHFWLSYALLVVAGACMYAPYGPFFAIVPEILPANVAGGA
MALINSMGALGSFGGSWLVGYLNGATGGPGASYLFMCGALLTAVALTAALNTSQTSGRAK
RDSSRLAMNH