Protein Info for PP_3371 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 signal peptide" amino acids 5 to 11 (7 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details PF00512: HisKA" amino acids 201 to 261 (61 residues), 50.7 bits, see alignment E=1.5e-17 PF02518: HATPase_c" amino acids 308 to 416 (109 residues), 81.4 bits, see alignment E=6.8e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3371)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HI6 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PP_3371 Sensor histidine kinase (Pseudomonas putida KT2440)
MRRRLFWKLFLAFWLANTLTFLVGAGAFMLNELRGDTPGLRSLLATELQMLERHGERAGR
QLLDVSPQPQDVQVGLYDDQDRLLAGQTVHVARFEQALLDRDGRPLVLRASVATRVGMAP
RPRNLGPFVTGAVMSALFALLCSFYLTRPLTWLREAMGQVAQGRFDVRVRPRLGKRRDEI
VDLAEDCDRMAGQLKALVQAQQNLLHDISHELRSPLTRMHAAIGLMRQQPDRPDMLERVE
RESRRMDDLIEQLLTLARAQSRQGNSDFASVDVVELLAQIVEDARFEAGMKQCQVSLLAQ
GAFLMHGHEELLYRAFENVIRNAVRYTKPGTAVLVEAAPAPGGQWLQVCVSDHGPGVDPA
RLQRIFEPFDRGTDSSDGFGLGLAIAQRAIALHGGSITALAAATGGLRVRIELPQAIAT