Protein Info for PP_3357 in Pseudomonas putida KT2440

Updated annotation (from data): p-hydroxybenzaldehyde dehydrogenase vdh (EC 1.2.1.64)
Rationale: Specifically important in carbon source p-Coumaric acid. This gene is known as vdh and has vanillin dehydrogenase activity, but it is not required for growth on vanillin (PMID:25026441). Instead, its primary substrate in vivo seems to be p-hydroxybenzaldehyde (which is the product of hydroxycinnamoyl-CoA hydratase-lyase)
Original annotation: vanillin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 16 to 471 (456 residues), 472.2 bits, E=1.5e-145
• PF05893: LuxC
  • amino acids 136 to 318 (183 residues), 22.5 bits, E=4.9e-09

Best Hits

Swiss-Prot: 87% identical to VDH_PSEFL: Vanillin dehydrogenase (vdh) from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3357)

MetaCyc: 80% identical to vanillin dehydrogenase (Pseudomonas sp. HR199)
Vanillin dehydrogenase. [EC: 1.2.1.67]

Predicted SEED Role

"Vanillin dehydrogenase (Hydroxybenzaldehyde dehydrogenase) (EC 1.2.1.28)" in subsystem Phenylpropanoid compound degradation (EC 1.2.1.28)

MetaCyc Pathways

• vanillin and vanillate degradation II (2/2 steps found)
• 4-coumarate degradation (aerobic) (4/5 steps found)
• trans-caffeate degradation (aerobic) (3/4 steps found)
• superpathway of vanillin and vanillate degradation (7/10 steps found)
• 4-hydroxybenzoate biosynthesis IV (plants) (1/2 steps found)
• vanillin and vanillate degradation I (1/2 steps found)
• 1,3-dimethylbenzene degradation to 3-methylbenzoate (1/3 steps found)
• 1,4-dimethylbenzene degradation to 4-methylbenzoate (1/3 steps found)
• 3-chlorotoluene degradation II (1/3 steps found)
• D-phenylglycine degradation (1/3 steps found)
• toluene degradation to benzoate (1/3 steps found)
• 4-coumarate degradation (anaerobic) (3/6 steps found)
• 4-hydroxybenzoate biosynthesis I (eukaryotes) (2/5 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• benzoate biosynthesis II (CoA-independent, non-β-oxidative) (1/4 steps found)
• mandelate degradation to acetyl-CoA (11/18 steps found)
• 4-hydroxymandelate degradation (2/6 steps found)
• mandelate degradation I (1/5 steps found)
• salicin biosynthesis (1/6 steps found)
• toluene degradation IV (aerobic) (via catechol) (6/13 steps found)
• pinoresinol degradation (2/10 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation
• Biosynthesis of phenylpropanoids
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.28 or 1.2.1.64 or 1.2.1.67

Sequence Analysis Tools

See Q88HJ9 at UniProt or InterPro

Protein Sequence (482 amino acids)

>PP_3357 p-hydroxybenzaldehyde dehydrogenase vdh (EC 1.2.1.64) (Pseudomonas putida KT2440)
MLQVPLLIGGQSRPASDGRTFERCNPVTGEVVSQAAAATLADADAAVAAASAAFPAWAAL
APGERRSRLLAGADLLQARAAEFIAAAGETGAMANWYGFNVKLAANMLREAAAMTTQITG
EVIPSDVPGSFAMALRAPCGVVLGIAPWNAPVILATRAIAMPLACGNTVVLKASELSPAV
HRLIGQVLHDAGIGDGVVNVISNAPQDAPAIVERLIANPAVRRVNFTGSTHVGRIVGELA
ARHLKPALLELGGKAPLLVLDDADLDATVEAAAFGAYFNQGQICMSTERLVVDSCIADAF
VDKLAVKIAGLRAGDPQASTSVLGSLVSAAAGERIKALIDDAVAKGARLVSGGQLEGSIL
QPTLLDNVDASMRLYREESFGPVAVVLRAEGDEALLQLANDSEFGLSSAIFSRDTSRALA
LAQRVESGICHINGPTVHDEAQMPFGGVKSSGYGSFGSRTAIDQFTQLRWVTLQHGPRHY
PI