Protein Info for PP_3344 in Pseudomonas putida KT2440

Annotation: nickel ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 192 to 221 (30 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details PF12911: OppC_N" amino acids 12 to 55 (44 residues), 36.6 bits, see alignment 3.5e-13 TIGR02790: nickel ABC transporter, permease subunit NikC" amino acids 20 to 275 (256 residues), 369.6 bits, see alignment E=4.7e-115 PF00528: BPD_transp_1" amino acids 96 to 277 (182 residues), 122.3 bits, see alignment E=2e-39

Best Hits

Swiss-Prot: 64% identical to NIKC_ECOLI: Nickel transport system permease protein NikC (nikC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to ppu:PP_3344)

MetaCyc: 64% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport system permease protein NikC (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HL2 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PP_3344 nickel ABC transporter permease subunit (Pseudomonas putida KT2440)
MSVHAALRQPLLLRRPSLMIGLALVGLLAVLALFGHWIAPHDPDLVDLGQRLQAPDARHW
LGTDHLGRDLLSRLIVGTRLSLGSVMLTLALVLALGLAVGGVAGFVGGRTDLLLMRLCDM
FMTFPTLVLAFFFVTLLGTGLSNVIIAIALSHWAWYARMVRGLVIAQRGREYVLASRLAG
ASRWARLRQHVLPNIAGPLLVLATMDIGHMMLHVSGLSFLGLGVAPPTAEWGVMINDAKE
FIWTQPQLLLLPGLMIFFSVMAFNLLGDALRDRLDPAQERH