Protein Info for PP_3316 in Pseudomonas putida KT2440

Annotation: putative Chaperone-associated ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 940 PF02861: Clp_N" amino acids 129 to 247 (119 residues), 83 bits, see alignment E=1.2e-26 amino acids 203 to 284 (82 residues), 46.8 bits, see alignment E=1.9e-15 PF23569: NBD_SMAX1" amino acids 306 to 405 (100 residues), 36.1 bits, see alignment E=3.4e-12 PF05621: TniB" amino acids 308 to 463 (156 residues), 25.3 bits, see alignment E=5.3e-09 PF00004: AAA" amino acids 324 to 447 (124 residues), 57.3 bits, see alignment E=1.3e-18 amino acids 664 to 791 (128 residues), 33.7 bits, see alignment E=2.5e-11 PF17871: AAA_lid_9" amino acids 466 to 566 (101 residues), 109.5 bits, see alignment E=4.2e-35 PF07724: AAA_2" amino acids 658 to 827 (170 residues), 221.8 bits, see alignment E=3.2e-69 PF00158: Sigma54_activat" amino acids 660 to 785 (126 residues), 27.8 bits, see alignment E=1.1e-09 PF07728: AAA_5" amino acids 663 to 784 (122 residues), 38 bits, see alignment E=9e-13 PF10431: ClpB_D2-small" amino acids 833 to 913 (81 residues), 79.3 bits, see alignment E=9.6e-26

Best Hits

Swiss-Prot: 49% identical to CLPB_OCEIH: Chaperone protein ClpB (clpB) from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

KEGG orthology group: K03696, ATP-dependent Clp protease ATP-binding subunit ClpC (inferred from 100% identity to ppu:PP_3316)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HN7 at UniProt or InterPro

Protein Sequence (940 amino acids)

>PP_3316 putative Chaperone-associated ATPase (Pseudomonas putida KT2440)
MLRQAPSRHLNDSRSARMASKQCQVCGQPATTRVEAKVNGRHSIMLLCDDHYRQLVRQQK
RTLSPLEALFGSRSGLFEEFMGSDLLRIGEDSASVATDADEVAEASSGEPGRAASGTPRR
RSSGLASRISEHSEALLQEAAKRATEFGRSEVDTEHLLLALADSDVVKTILSQFKIKVDE
LKRQIEAEAKRGDKPFEGEVGVSPRVKDALSRAFVASNELGHAYVGPEHFLIGLAEEGEG
LAANLLRRYGLMPQALRQCVSKVVGKGAEDGRAEAPTETPELDKYSRDLTRMARDGKLDP
VIGRAQEIETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQRMVAGEVPETLRDKRLVE
LNINSLVAGAKYRGEFEERVQKVLKEIAEHQGELILFIDEVHTIVGAGQGGGEGGLDVAN
VFKPMMARGELNLIGATTLNEYQKYIEQDAALERRFQPVVVPEPTVAQTIMILRGLRDTF
EAHHKVSITEEAIIAAAELSDRYVSARFLPDKAIDLLDQAAARVKLSATARPVAVQEMES
ELHQLRREQDYAASRKQYDNAAQISKRVEATEAELKQRVEEWERERGSGSTEVKAEHVAQ
IVSRLTGIPVNELTVEEREKLLHLEQRLHERLVGQDEAVRAVADAVRLSRAGLREGSKPV
ATFLFLGSTGVGKTELAKALAETIYGDESALLRIDMSEYGERHSVARLVGAPPGYVGYDE
GGQLTEKVRRKPYSVLLLDEIEKAHADVYNILLQVFDDGRLTDGKGRVVDFTNTIIIATS
NLGSDIIQRRLKAPGAAGEEYEKTKVEVMEVLRGHFRPEFLNRIDEIIVFHALGKQEIRH
IVGLQLERVARNAASQGVTLTFDETLVDHLAQVGYKPEFGARELKRLIRSELETALAREM
LGGGIGKGDHAHVRWDDKAERVGFDRRQAAPAKELDSENA