Protein Info for PP_3308 in Pseudomonas putida KT2440

Annotation: promiscuous aromatic aldehyde dehydrogenase, 2Fe-2S subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 17 to 64 (48 residues), 36.3 bits, E=4.5e-13
• PF01799: Fer2_2
  • amino acids 84 to 157 (74 residues), 104.7 bits, E=2.3e-34

Best Hits

Swiss-Prot: 47% identical to CUTC_SULAC: Glyceraldehyde dehydrogenase small chain (cutC) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to ppu:PP_3308)

MetaCyc: 48% identical to glycolaldehyde oxidoreductase small subunit (Saccharolobus solfataricus P2)
1.2.99.-

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

MetaCyc Pathways

• L-arabinose degradation IV (4/8 steps found)
• D-xylose degradation IV (3/7 steps found)
• superpathway of pentose and pentitol degradation (10/42 steps found)

Sequence Analysis Tools

See Q88HP5 at UniProt or InterPro

Protein Sequence (175 amino acids)

>PP_3308 promiscuous aromatic aldehyde dehydrogenase, 2Fe-2S subunit (Pseudomonas putida KT2440)
MSAISPNGAEEHPIGLTLNGQRLTLQVNPWTTLLDLLREQLDLVGTKKGCDHGQCGACTV
LRDGKRVNACLTLAIMCDGAELVTIEGLASGDVLHPMQRAFITHDAFQCGYCTPGQICSA
VGLAREGRAYTREAIREQMSGNLCRCGAYSNIVAAVEEALPLMTDLAPPQRGPNP