Protein Info for PP_3305 in Pseudomonas putida KT2440

Annotation: Membrane protein, TerC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 16 to 321 (306 residues), 399.1 bits, see alignment E=7.5e-124 PF03741: TerC" amino acids 82 to 290 (209 residues), 182.7 bits, see alignment E=2.8e-58

Best Hits

Swiss-Prot: 47% identical to Y786_RICPR: Uncharacterized membrane protein RP786 (RP786) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 100% identity to ppu:PP_3305)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HP8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PP_3305 Membrane protein, TerC family (Pseudomonas putida KT2440)
MSALSTYLYQDVLGTDLWLWLSFFAVVLTLLALDLGVLHRGNREIGVKESLLLSAGYISM
GLLFAVWVYFQKGSDASMDYVTGFLIEKSLSMDNVFVIALIFSFLAIPREFQHRVLFWGI
MGVIVLRAIMIGLGAALIAQFSWILYCFGAFLVFTGVKMLFARVDHAPDLENNRFVNYLR
THLRITKELHAQRFVIRLPDASGKRILWVTPLFLALILIECADLVFAVDSVPAIFAITQD
PFIVYTSNIFAILGLRALYFALAAMISRFVYLKYALALVLVFIGSKIFLHDIVGKVPAEI
SLSITIGLLIGGVLLSLWKTRASANAS