Protein Info for PP_3287 in Pseudomonas putida KT2440

Annotation: transcriptional regulator with 4Fe-4S cluster; Crp/Fnr family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00027: cNMP_binding" amino acids 61 to 145 (85 residues), 52.7 bits, see alignment E=5.3e-18 PF13545: HTH_Crp_2" amino acids 179 to 253 (75 residues), 58.2 bits, see alignment E=9.7e-20 PF00325: Crp" amino acids 204 to 233 (30 residues), 28.8 bits, see alignment (E = 1.2e-10)

Best Hits

Swiss-Prot: 41% identical to BTR_BORPE: Transcriptional regulatory protein btr (btr) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 100% identity to ppu:PP_3287)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HR6 at UniProt or InterPro

Protein Sequence (265 amino acids)

>PP_3287 transcriptional regulator with 4Fe-4S cluster; Crp/Fnr family (Pseudomonas putida KT2440)
MPGQLKVTLLDSPNPLSKANPIHLKPLVNHCMDCRVSGLCLPTGLPVDENSCLGALIGPR
MRIRKGAALFNANDPLTMLYALRCGSFKTSLNTAEGQGVVINFWMPGDVIGLDAIATEHH
VCDAIALEDSEVCPVPYRRLQTLAREFPDLQQSLNRLMSREIVREHGRVLMLCNLTAEQR
LASFLVGLSRRFVSRGYSAHGFMLRMSREDMASYLGLRLETVCRSVARLRALGIVDLHGR
LVEILDMPALMALEQGGGECEAKGP