Protein Info for PP_3286 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional repressor PaaX(phenylacetyl-CoA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF07848: PaaX" amino acids 21 to 89 (69 residues), 108.6 bits, see alignment E=2.2e-35 TIGR02277: phenylacetic acid degradation operon negative regulatory protein PaaX" amino acids 24 to 304 (281 residues), 328.3 bits, see alignment E=2.3e-102 PF20803: PaaX_M" amino acids 107 to 179 (73 residues), 29.5 bits, see alignment E=9.7e-11 PF08223: PaaX_C" amino acids 193 to 282 (90 residues), 105.8 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 43% identical to PAAX_ECOLI: Transcriptional repressor PaaX (paaX) from Escherichia coli (strain K12)

KEGG orthology group: K02616, phenylacetic acid degradation operon negative regulatory protein (inferred from 100% identity to ppu:PP_3286)

Predicted SEED Role

"Phenylacetic acid degradation operon negative regulatory protein PaaX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HR7 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PP_3286 DNA-binding transcriptional repressor PaaX(phenylacetyl-CoA) (Pseudomonas putida KT2440)
MSNLAPLNHLITRFQEQTPIRASSLIITLYGDAIEPHGGTVWLGSLINLLEPIGINERLI
RTSIFRLTKEGWLTAEKVGRRSYYSLTGTGRRRFEKAFKRVYSPSQPAWDGAWTLVLLSQ
LEAGKRKAVREELEWQGFGVMAPNLLGCPRADRADLVATLHDLEAGDDSIVFETHTQEVL
ASKAMRAQVRESWRIDELGQQYSEFIQLFRPLWQGLKEQPLLDAQDCFLARTLLIHEYRR
LLLRDPQLPDELLPGDWEGRAARQLCRNLYRLVFAKAEEWLNAALETADGPLPDVSESFY
KRFGGLA