Protein Info for PP_3274 in Pseudomonas putida KT2440

Annotation: ring 1,2-phenylacetyl-CoA epoxidase, reductase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR02160: phenylacetate-CoA oxygenase/reductase, PaaK subunit" amino acids 4 to 356 (353 residues), 465.9 bits, see alignment E=3.5e-144 PF00970: FAD_binding_6" amino acids 8 to 103 (96 residues), 45.2 bits, see alignment E=1.6e-15 PF00175: NAD_binding_1" amino acids 118 to 226 (109 residues), 58.2 bits, see alignment E=1.9e-19 PF00111: Fer2" amino acids 273 to 346 (74 residues), 64.2 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: K02613, phenylacetic acid degradation NADH oxidoreductase (inferred from 100% identity to ppu:PP_3274)

MetaCyc: 82% identical to ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (Pseudomonas sp. Y2)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase/reductase, PaaK subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HS9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PP_3274 ring 1,2-phenylacetyl-CoA epoxidase, reductase subunit (Pseudomonas putida KT2440)
MSQFHSLTIKQVRNETRDAVSIAFDVPEHLQGQFRFTQGQYLVMRTQLDNEEVRRSYSIC
SAVQDGELRVAVKRVPGGRFSAFANEVLKAGQQLEVMPPSGSFFVPLDPARQGNYLGVAA
GSGITPILSIIATTLASEPHSRFTLLYGNRSSSGALFRDKLEDLKNRYLDRLNLIFVFSR
EQQDVDLYNGRIDADKCGQLFSRWLDVAGLDAAFICGPQAMTETVRDSLQANGMAKERIH
FELFAAAGSEARREAREAARQVDSALSHITVISDGRALSFDLPRNTQNVLDAGNAIGAEL
PYSCKAGVCSTCKCRVIEGEVEMDSNHALEDYEVAAGYVLSCQTYPVSDKVVLDFDQL