Protein Info for PP_3247 in Pseudomonas putida KT2440

Annotation: Transporter, bile acid/Na+ symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details PF01758: SBF" amino acids 12 to 195 (184 residues), 131.5 bits, see alignment E=3.1e-42 PF13593: SBF_like" amino acids 14 to 276 (263 residues), 52.4 bits, see alignment E=5.2e-18

Best Hits

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 100% identity to ppf:Pput_2515)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HV6 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PP_3247 Transporter, bile acid/Na+ symporter family (Pseudomonas putida KT2440)
MTASPLLTAFLPLALGIIMLGLGLSLTLADFARVVKYPKPVVVGLVCQILLLPLVCFLIA
NGFGLESALAVGLMLLAASPGGTTANLFSHLAHGDVALNITLTAVNSLIAILTMPLLVNL
SLSWFMASDQAIPLQFAKVMQVFAIVLLPVALGMLIRHFAPAFAARMEKPMKLVAALFLA
FTIVLALAKDWQTVVEYAPVVGLAALLFNLLSLTVGYWVPRLLNISKRQAIAIGMEIGIH
NGTLAIALALSPSLLNNATMAVPAALYSLIMFFTAAGFGWWVSRGHVAAEPKGETVN